PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010088443.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Moraceae; Morus
Family NF-YB
Protein Properties Length: 261aa    MW: 27388.2 Da    PI: 7.127
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010088443.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB169.63.7e-5357152297
           NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                     reqd+++Pianv+rim+++lP++akis+daket+qecvse+isf+t+ea+d+cqre+rkt++++d+lwa+a+lGf+dyvepl+v+l++yre e+e
  XP_010088443.1  57 REQDQYMPIANVIRIMRRILPSHAKISDDAKETIQECVSEYISFITGEANDRCQREQRKTVTAEDVLWAMAKLGFDDYVEPLTVFLNRYRESETE 151
                     89*******************************************************************************************99 PP

           NF-YB  97 k 97 
                     +
  XP_010088443.1 152 R 152
                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.105.3E-4852154IPR009072Histone-fold
SuperFamilySSF471131.86E-3659156IPR009072Histone-fold
PfamPF008084.2E-2562126IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.7E-1690108No hitNo description
PROSITE patternPS00685093109IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.7E-16109127No hitNo description
PRINTSPR006157.7E-16128146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045723Biological Processpositive regulation of fatty acid biosynthetic process
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 261 aa     Download sequence    Send to blast
MERMSGFHGY RKHAKSSSAL NIAMANDTNS NSNINTGGGR GGGGGGGERP QTPCVIREQD  60
QYMPIANVIR IMRRILPSHA KISDDAKETI QECVSEYISF ITGEANDRCQ REQRKTVTAE  120
DVLWAMAKLG FDDYVEPLTV FLNRYRESET ERTNPGRHEP FLRRGSSGSG GGGGGGGGGG  180
GSSSSIGMME YGGGIANAAH HLNIGGVGPY GPGFNLGPYP GPGTLDPTNG YFRDGSGGVG  240
LGGGSSSQNV LGGYDPFAQF K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A2e-3857147393NF-YB
4awl_B2e-3857147494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A2e-3857147494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13745GGRGGGGGG
2168181SGGGGGGGGGGGGS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010088443.10.0Nuclear transcription factor Y subunit B-9
SwissprotQ9SFD85e-69NFYB9_ARATH; Nuclear transcription factor Y subunit B-9
TrEMBLW9R1D40.0W9R1D4_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.17e-66NF-YB family protein